- Recombinant Sorghum bicolor CASP-like protein Sb04g005230 (Sb04g005230)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1046789
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 20,317 Da
- E Coli or Yeast
- 1-194
- Sb04g005230
- CASP-like protein Sb04g005230 (Sb04g005230)
Sequence
MAAGQPRPPPPPSSVRTERVLRAACAAMAAAGALLLGFSAETKTVIFVQKKAVPKDVQALWVLIVAAAAAAAYHAAQLARCLCMDRLAGGGGGCRRLRRAVACATFLLDKGCAYMVLATTVAALQACFVGLLGVEALQWSKLCNIYTRFCEQAAAGMVCSLVAAAGMAVLSAFSARDLFRRRRPCSPCVQVQQV